제품 > 항체 > 다중클론항체(pAb)

[KD Validated] PROM1 Rabbit pAb (A21701)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from HT-29 cells, using [KD Validated] PROM1 Rabbit pAb (A21701) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from wild type(WT) and PROM1 knockdown (KD) HCT116 cells, using [KD Validated] PROM1 Rabbit pAb (A21701) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - [KD Validated] PROM1 Rabbit pAb (A21701)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using CD133 Rabbit pAb (A21701) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using CD133 Rabbit pAb (A21701) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung using CD133 Rabbit pAb (A21701) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KD Validated] PROM1 Rabbit pAb (A21701)

Immunofluorescence analysis of C6 cells using [KD Validated] PROM1 Rabbit pAb (A21701) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HT-29 cells using [KD Validated] PROM1 Rabbit pAb (A21701) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KD Validated] PROM1 Rabbit pAb (A21701)

Immunoprecipitation analysis of 200 μg extracts of HT-29 cells using 3 μg CD133 antibody (A21701). Western blot was performed from the immunoprecipitate using CD133 antibody (A21701) at a dilution of 1:1000.

Overview

Product name	[KD Validated] PROM1 Rabbit pAb
Catalog No.	A21701
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 179-433 of human PROM1 (NP_006008.1).
Sequence	ANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSY
Gene ID
Swiss Prot
Synonyms	RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061; [KD Validated] PROM1
Calculated MW	97kDa
Observed MW	120kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HT-29, HCT116
Cellular location	Apical cell membrane, Cell projection, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment, Multi-pass membrane protein, cilium, microvillus membrane, photoreceptor outer segment.
Customer validation	Other(Mus musculus)