Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | KIAA0101 Rabbit pAb |
---|---|
Catalog No. | A10357 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1). |
---|---|
Sequence | SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE |
Gene ID | |
Swiss Prot | |
Synonyms | L5; PAF; OEATC; PAF15; OEATC1; p15PAF; NS5ATP9; OEATC-1; p15/PAF; KIAA0101; p15(PAF) |
Calculated MW | 12kDa |
Observed MW | 12kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HT-29, K-562 |
Cellular location | Cytoplasm, Nucleus, perinuclear region |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.