KIF2B Rabbit pAb (A13600)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Overview

Product name	KIF2B Rabbit pAb
Catalog No.	A13600
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Predicted to enable microtubule binding activity and microtubule motor activity. Involved in metaphase plate congression; microtubule depolymerization; and regulation of chromosome segregation. Located in intercellular bridge; mitotic spindle; and nucleolus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 544-673 of human KIF2B (NP_115948.4).
Sequence	NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE
Gene ID
Swiss Prot
Synonyms	KIF2B
Calculated MW	76kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples
Cellular location	Chromosome, Cytoplasm, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center, spindle