제품 > 항체 > 다중클론항체(pAb)

KIF3A Rabbit pAb (A6639)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KIF3A Rabbit pAb (A6639) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - KIF3A Rabbit pAb (A6639)

Immunohistochemistry analysis of paraffin-embedded Rat testis using KIF3A Rabbit pAb (A6639) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KIF3A Rabbit pAb (A6639)

Immunofluorescence analysis of MCF7 cells using KIF3A Rabbit pAb (A6639). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - KIF3A Rabbit pAb (A6639)

Immunoprecipitation analysis of 200 μg extracts of MCF-7 cells, using 3 μg KIF3A antibody (A6639). Western blot was performed from the immunoprecipitate using KIF3A antibody (A6639) at a dilution of 1:1000.

Overview

Product name	KIF3A Rabbit pAb
Catalog No.	A6639
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables protein phosphatase binding activity; small GTPase binding activity; and spectrin binding activity. Involved in protein localization to cell junction and protein transport. Located in centriole and centrosome. Part of kinesin II complex. Colocalizes with spindle microtubule.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 430-699 of human KIF3A (NP_008985.3).
Sequence	RKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ
Gene ID
Swiss Prot
Synonyms	FLA10; KLP-20; KIF3A
Calculated MW	80kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	MCF-7, SW480, 293T, SKOV3, HeLa, Mouse brain, Mouse ovary, Rat liver, Rat brain
Cellular location	Cell projection, Cytoplasm, cilium, cytoskeleton
Customer validation	IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KIF3A Rabbit pAb images

Western blot - KIF3A Rabbit pAb (A6639)

Immunohistochemistry - KIF3A Rabbit pAb (A6639)

Immunofluorescence - KIF3A Rabbit pAb (A6639)

Immunofluorescence analysis of MCF7 cells using KIF3A Rabbit pAb (A6639). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - KIF3A Rabbit pAb (A6639)

* For research use only. Not for therapeutic or diagnostic purposes.