제품 > 항체 > 다중클론항체(pAb)

[KO Validated] Annexin A5/Annexin V Rabbit pAb (A1728)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using Annexin A5/Annexin V antibody (A1728) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Western blot analysis of extracts from normal (control) and Annexin A5/Annexin V knockout (KO) 293T cells, using Annexin A5/Annexin V antibody (A1728) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] Annexin A5/Annexin V Rabbit pAb (A1728)

Immunofluorescence analysis of HeLa cells using [KO Validated] Annexin A5/Annexin V Rabbit pAb (A1728) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review

Overview

Product name	[KO Validated] Annexin A5/Annexin V Rabbit pAb
Catalog No.	A1728
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Annexin 5 gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. Polymorphisms in this gene have been implicated in various obstetric complications.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human Annexin A5/Annexin V (NP_001145.1).
Sequence	MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Gene ID
Swiss Prot
Synonyms	PP4; ANX5; ENX2; CPB-I; RPRGL3; HEL-S-7; VAC-alph
Calculated MW	36kDa
Observed MW	35kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, HeLa, DU145, PC-3, Mouse lung
Cellular location	cytoplasm, cytosol, external side of plasma membrane, extracellular exosome, extracellular region, focal adhesion
Customer validation	(Human prostate) WB(Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구암침습 및 전이

[KO Validated] Annexin A5/Annexin V Rabbit pAb images

Western blot - [KO Validated] Annexin A5/Annexin V Rabbit pAb (A1728)

Immunofluorescence - [KO Validated] Annexin A5/Annexin V Rabbit pAb (A1728)

Immunofluorescence analysis of HeLa cells using [KO Validated] Annexin A5/Annexin V Rabbit pAb (A1728) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.