제품 > 항체 > 다중클론항체(pAb)

[KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type (WT) and HIF1AN/FIH1 knockout (KO) 293T cells, using [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466)

Immunohistochemistry analysis of HIF1AN/FIH1 in paraffin-embedded Mouse kidney tissue using [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HIF1AN/FIH1 in paraffin-embedded Human breast cancer tissue using [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HIF1AN/FIH1 in paraffin-embedded Rat kidney tissue using [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466)

Immunofluorescence analysis of L929 cells using [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 1 μg HIF1AN/FIH1 antibody (A5466). Western blot was performed from the immunoprecipitate using HIF1AN/FIH1 antibody (A5466) at a dilution of 1:1000.

Overview

Product name	[KO Validated] HIF1AN/FIH1 Rabbit pAb
Catalog No.	A5466
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human HIF1AN/FIH1 (NP_060372.2).
Sequence	MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Gene ID
Swiss Prot
Synonyms	FIH1; H1
Calculated MW	41kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	MCF7, K-562, U-937, 293T, Mouse heart, Mouse skeletal muscle
Cellular location	Cytoplasm, Nucleus, perinuclear region
Customer validation	WB(Homo sapiens, Mus musculus, Other)