Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using [KO Validated] PDCD4 Rabbit pAb (A2570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of lysates from wild type (WT) and PDCD4 knockout (KO) 293T cells, using [KO Validated] PDCD4 Rabbit pAb (A2570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using [KO Validated] PDCD4 Rabbit pAb (A2570) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Product name | [KO Validated] PDCD4 Rabbit pAb |
|---|---|
| Catalog No. | A2570 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PDCD4 (NP_055271.2). |
|---|---|
| Sequence | MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H731; D4 |
| Calculated MW | 52kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | 293T, HeLa, MCF7, Mouse thymus |
| Cellular location | Cytoplasm, Nucleus |
| Customer validation | WB(Rattus norvegicus, Sus scrofa, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2570? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KO Validated] PDCD4 Rabbit pAb (A2570)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2570_P6458_WB_01.jpg?t=1715049011 "ABclonal:Western blot - [KO Validated] PDCD4 Rabbit pAb (A2570)")
![ABclonal:Western blot - [KO Validated] PDCD4 Rabbit pAb (A2570)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2570_P6458_KO-WB_01.jpg?t=1715049011 "ABclonal:Western blot - [KO Validated] PDCD4 Rabbit pAb (A2570)")
![ABclonal:Immunohistochemistry - [KO Validated] PDCD4 Rabbit pAb (A2570)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2570_P6458(2)_IHC_01.jpg?t=1715049011 "ABclonal:Immunohistochemistry - [KO Validated] PDCD4 Rabbit pAb (A2570)")
![ABclonal:Immunohistochemistry - [KO Validated] PDCD4 Rabbit pAb (A2570)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2570_P6458(2)_IHC_02.jpg?t=1715049011 "ABclonal:Immunohistochemistry - [KO Validated] PDCD4 Rabbit pAb (A2570)")
