제품 > 항체 > 다중클론항체(pAb)

[KO Validated] S100A6 Rabbit pAb (A4104)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and S100A6 knockout (KO) HeLa cells, using [KO Validated] S100A6 Rabbit pAb (A4104) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of various lysates using [KO Validated] S100A6 Rabbit pAb (A4104) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	[KO Validated] S100A6 Rabbit pAb
Catalog No.	A4104
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (NP_055439.1).
Sequence	MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Gene ID
Swiss Prot
Synonyms	2A9; PRA; 5B10; CABP; CACY; S10A6; A6
Calculated MW	10kDa
Observed MW	10kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Mouse lung, Rat lung
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus envelope, Peripheral membrane protein