Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] SOD2 Rabbit mAb |
---|---|
Catalog No. | A19576 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0055 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOD2 (P04179). |
---|---|
Sequence | MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSI |
Gene ID | |
Swiss Prot | |
Synonyms | GC1; IPOB; IPO-B; MNSOD; MVCD6; GClnc1; Mn-SOD; D2 |
Calculated MW | 25kDa |
Observed MW | 22kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, HepG2, NIH/3T3, RAW264.7, Rat brain, Rat heart |
Cellular location | Mitochondrion matrix. |
Customer validation | WB(Homo sapiens, Sus scrofa, Rattus norvegicus, Mus musculus) IHC(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19576? Please let us know so that we can cite the reference in this datasheet.