Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | LC3B Mouse mAb |
---|---|
Catalog No. | A17424 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG2a, Kappa |
CloneNo. | AMC0036 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (NP_073729.1). |
---|---|
Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
Gene ID | |
Swiss Prot | |
Synonyms | LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3 |
Calculated MW | 15kDa |
Observed MW | 14-15kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa treated by Chloroquine , NIH/3T3, C6 |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17424? Please let us know so that we can cite the reference in this datasheet.