제품 > 항체 > 다중클론항체(pAb)

LDL Receptor (LDLR) Rabbit pAb (A14996)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LDL Receptor (LDLR) Rabbit pAb (A14996) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Rat brain, using LDL Receptor (LDLR) Rabbit pAb (A14996) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - LDL Receptor (LDLR) Rabbit pAb (A14996)

Immunohistochemistry analysis of paraffin-embedded Rat kidney using LDL Receptor (LDLR) Rabbit pAb (A14996) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - LDL Receptor (LDLR) Rabbit pAb (A14996)

Immunofluorescence analysis of NIH/3T3 cells using LDL Receptor (LDLR) Rabbit pAb (A14996) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	LDL Receptor (LDLR) Rabbit pAb
Catalog No.	A14996
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. The encoded protein is normally bound at the cell membrane, where it binds low density lipoprotein/cholesterol and is taken into the cell. Lysosomes release the cholesterol, which is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 761-860 of human LDL Receptor (LDLR) (NP_000518.1).
Sequence	TVEIVTMSHQALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA
Gene ID
Swiss Prot
Synonyms	FH; FHC; FHCL1; LDLCQ2; LDL Receptor (LDLR)
Calculated MW	95kDa
Observed MW	100-160kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, HepG2, Mouse lung, Mouse liver, Rat brain
Cellular location	Cell membrane, Cell surface, Early endosome, Endomembrane system, Golgi apparatus, Late endosome, Lysosome, Membrane, Single-pass type I membrane protein, clathrin-coated pit.
Customer validation	WB(Mus musculus, Rattus norvegicus)