Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | LDL Receptor (LDLR) Rabbit pAb |
---|---|
Catalog No. | A14996 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 761-860 of human LDL Receptor (LDLR) (NP_000518.1). |
---|---|
Sequence | TVEIVTMSHQALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA |
Gene ID | |
Swiss Prot | |
Synonyms | FH; FHC; FHCL1; LDLCQ2; LDL Receptor (LDLR) |
Calculated MW | 95kDa |
Observed MW | 100-160kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, HepG2, Mouse lung, Mouse liver, Rat brain |
Cellular location | Cell membrane, Cell surface, Early endosome, Endomembrane system, Golgi apparatus, Late endosome, Lysosome, Membrane, Single-pass type I membrane protein, clathrin-coated pit. |
Customer validation | WB(Mus musculus, Rattus norvegicus) IP(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14996? Please let us know so that we can cite the reference in this datasheet.