제품 > 항체 > 다중클론항체(pAb)

LHB/CGB1 Rabbit pAb (A24859)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with LHB/CGB1 using Lutropin subunit beta Rabbit pAb(A24859) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunohistochemistry - LHB/CGB1 Rabbit pAb (A24859)

Immunohistochemistry analysis of LHB/CGB1 in paraffin-embedded Human pituitary gland tissue using LHB/CGB1 Rabbit pAb (A24859) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	LHB/CGB1 Rabbit pAb
Catalog No.	A24859
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 21-141of human LHB(NP_000885.1).
Sequence	SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Gene ID
Swiss Prot
Synonyms	LHB; CGB4; HH23; LSH-B; LSH-beta; lutropin subunit beta; Lutropin subunit beta
Calculated MW	15kDa
Observed MW	15-30kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T transfected with LHB/CGB1
Cellular location	Secreted