Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | LHB/CGB1 Rabbit pAb |
---|---|
Catalog No. | A24859 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to a sequence within amino acids 21-141of human LHB(NP_000885.1). |
---|---|
Sequence | SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
Gene ID | |
Swiss Prot | |
Synonyms | LHB; CGB4; HH23; LSH-B; LSH-beta; lutropin subunit beta; Lutropin subunit beta |
Calculated MW | 15kDa |
Observed MW | 15-30kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T transfected with LHB/CGB1 |
Cellular location | Secreted |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.