Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | LOX Rabbit mAb |
---|---|
Catalog No. | A11504 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0624 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300). |
---|---|
Sequence | GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
Gene ID | |
Swiss Prot | |
Synonyms | AAT10; LOX |
Calculated MW | 47kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | 293T, A549, Jurkat, Mouse lung, Rat lung, Rat spleen |
Cellular location | Secreted, extracellular space. |
Customer validation | IHC(Homo sapiens) WB(Mus musculus, Homo sapiens) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus) FC(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11504? Please let us know so that we can cite the reference in this datasheet.