제품 > 항체 > 단일클론항체(mAb)

LOX Rabbit mAb (A11504)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - LOX Rabbit mAb (A11504)

Western blot analysis of various lysates using LOX Rabbit mAb (A11504) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - LOX Rabbit mAb (A11504)

Immunohistochemistry analysis of paraffin-embedded Human colon using LOX Rabbit mAb (A11504) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using LOX Rabbit mAb (A11504) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast tissue using LOX Rabbit mAb (A11504) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using LOX Rabbit mAb (A11504) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using LOX Rabbit mAb (A11504) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - LOX Rabbit mAb (A11504)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg LOX antibody (A11504). Western blot was performed from the immunoprecipitate using LOX antibody (A11504) at a dilution of 1:1000.

Overview

Product name	LOX Rabbit mAb
Catalog No.	A11504
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0624

Background

This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300).
Sequence	GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Gene ID
Swiss Prot
Synonyms	AAT10; LOX
Calculated MW	47kDa
Observed MW	56kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	293T, A549, Jurkat, Mouse lung, Rat lung, Rat spleen
Cellular location	Secreted, extracellular space.
Customer validation	IHC(Homo sapiens) WB(Mus musculus, Homo sapiens) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus)