Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | LXRα Rabbit mAb |
---|---|
Catalog No. | A3974 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0877 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXRα (Q13133). |
---|---|
Sequence | MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV |
Gene ID | |
Swiss Prot | |
Synonyms | LXRA; LXR-a; RLD-1; LXRα |
Calculated MW | 50kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, HepG2, Mouse liver, Mouse kidney, Mouse stomach, Rat liver |
Cellular location | Nucleus. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens) IHC(Rattus norvegicus) IF(Rattus norvegicus) ELISA(Rattus norvegicus) IF(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3974? Please let us know so that we can cite the reference in this datasheet.