제품 > 항체 > 다중클론항체(pAb)

LY6E Rabbit pAb (A10225)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of Rat lung, using LY6E antibody (A10225) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - LY6E Rabbit pAb (A10225)

Immunofluorescence analysis of L929 cells using LY6E Rabbit pAb (A10225) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	LY6E Rabbit pAb
Catalog No.	A10225
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the human Ly6 gene family and encodes a glycosylphosphatidyl-inositol (GPI)-anchored cell surface protein. The protein plays an important role in T cell physiology, oncogenesis and immunological regulation. The protein is also involved in modulation of viral infection by coronaviruses, SARS-CoV, MERS-CoV and SARS-CoV-2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human LY6E (NP_002337.1).
Sequence	LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Gene ID
Swiss Prot
Synonyms	RIGE; SCA2; RIG-E; SCA-2; TSA-1
Calculated MW	14kDa
Observed MW	14kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat lung
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor
Customer validation	WB(Homo sapiens)