Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MAD2B/MAD2L2 Rabbit mAb |
---|---|
Catalog No. | A4630 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1126 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAD2B/MAD2B/MAD2L2 (Q9UI95). |
---|---|
Sequence | FEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQ |
Gene ID | |
Swiss Prot | |
Synonyms | REV7; FANCV; MAD2B; POLZ2; MAD2B/MAD2L2 |
Calculated MW | 24kDa |
Observed MW | 24kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, Jurkat, SH-SY5Y, Mouse testis |
Cellular location | Cytoplasm, Nucleus, cytoskeleton, spindle |
Customer validation | IF(Homo sapiens, Mus musculus) IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4630? Please let us know so that we can cite the reference in this datasheet.