제품 > 항체 > 단일클론항체(mAb)

MAD2B/MAD2L2 Rabbit mAb (A4630)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MAD2B/MAD2B/MAD2L2 Rabbit mAb (A4630) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - MAD2B/MAD2L2 Rabbit mAb (A4630)

Immunohistochemistry analysis of paraffin-embedded Rat brain using MAD2B/MAD2B/MAD2L2 Rabbit mAb (A4630) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon using MAD2B/MAD2B/MAD2L2 Rabbit mAb (A4630) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using MAD2B/MAD2B/MAD2L2 Rabbit mAb (A4630) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit mAb (A4630)

Immunofluorescence analysis of C6 cells using MAD2B/MAD2B/MAD2L2 Rabbit mAb (A4630) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using MAD2B/MAD2B/MAD2L2 Rabbit mAb (A4630) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	MAD2B/MAD2L2 Rabbit mAb
Catalog No.	A4630
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1126

Background

The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAD2B/MAD2B/MAD2L2 (Q9UI95).
Sequence	FEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQ
Gene ID
Swiss Prot
Synonyms	REV7; FANCV; MAD2B; POLZ2; MAD2B/MAD2L2
Calculated MW	24kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, Jurkat, SH-SY5Y, Mouse testis
Cellular location	Cytoplasm, Nucleus, cytoskeleton, spindle
Customer validation	IF(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens)