제품 > 항체 > 단일클론항체(mAb)

MAP1LC3A Rabbit mAb (A12319)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from NIH/3T3, C6 cells using MAP1LC3A Rabbit mAb (A12319) at 1:1000 dilution. NIH/3T3 cells and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from SH-SY5Y cells using MAP1LC3A Rabbit mAb (A12319) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - MAP1LC3A Rabbit mAb (A12319)

Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg MAP1LC3A antibody (A12319). Western blot was performed from the immunoprecipitate using MAP1LC3A antibody (A12319) at a dilution of 1:1000.NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.

Overview

Product name	MAP1LC3A Rabbit mAb
Catalog No.	A12319
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2636

Background

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (Q9H492).
Sequence	MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Gene ID
Swiss Prot
Synonyms	LC3; LC3A; ATG8E; MAP1ALC3; MAP1BLC3; MAP1LC3A
Calculated MW	14kDa
Observed MW	14kDa, 16kDa/16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	NIH/3T3 treated by Chloroquine, C6 treated by Chloroquine, SH-SY5Y
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton.
Customer validation	WB(Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus) IF(Sus scrofa)