제품 > 항체 > 다중클론항체(pAb)

MCL1 Rabbit pAb (A0250)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using MCL1 Rabbit pAb (A0250) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - MCL1 Rabbit pAb (A0250)

Immunohistochemistry analysis of paraffin-embedded mouse brain using MCL1 Rabbit pAb (A0250) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MCL1 Rabbit pAb (A0250)

Immunofluorescence analysis of NIH/3T3 cells using MCL1 Rabbit pAb (A0250) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	MCL1 Rabbit pAb
Catalog No.	A0250
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MCL1 (NP_068779.1).
Sequence	SGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
Gene ID
Swiss Prot
Synonyms	TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT; MCL1
Calculated MW	37kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	BT-474, Raji, Mouse lung, Mouse thymus
Cellular location	Cytoplasm, Membrane, Mitochondrion, Nucleus, Single-pass membrane protein, nucleoplasm
Customer validation	(HeLa cells) WB(Homo sapiens, Mus musculus, Mus musculus)