제품 > 항체 > 단일클론항체(mAb)

MCM5 Rabbit mAb (A5008)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MCM5 Rabbit mAb (A5008) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - MCM5 Rabbit mAb (A5008)

Immunohistochemistry analysis of paraffin-embedded Rat testis using MCM5 Rabbit mAb (A5008) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon using MCM5 Rabbit mAb (A5008) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - MCM5 Rabbit mAb (A5008)

Immunoprecipitation analysis of 300 μg extracts of MCF7 cells using 3 μg MCM5 antibody (A5008). Western blot was performed from the immunoprecipitate using MCM5 antibody (A5008) at a dilution of 1:1000.

Overview

Product name	MCM5 Rabbit mAb
Catalog No.	A5008
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1239

Background

The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 635-734 of human MCM5 (P33992).
Sequence	ADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK
Gene ID
Swiss Prot
Synonyms	CDC46; MGORS8; P1-CDC46; MCM5
Calculated MW	82kDa
Observed MW	82kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, MCF7, Mouse spleen, Rat testis
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)