제품 > 항체 > 다중클론항체(pAb)

MCTS1 Rabbit pAb (A9061)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MCTS1 Rabbit pAb (A9061) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - MCTS1 Rabbit pAb (A9061)

Immunofluorescence analysis of C6 cells using MCTS1 Rabbit pAb (A9061) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using MCTS1 Rabbit pAb (A9061) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2OS cells using MCTS1 Rabbit pAb (A9061) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	MCTS1 Rabbit pAb
Catalog No.	A9061
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable translation initiation factor activity. Involved in IRES-dependent viral translational initiation; formation of translation preinitiation complex; and ribosome disassembly. Located in cytosol and plasma membrane. Colocalizes with cytosolic small ribosomal subunit.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human MCTS1 (NP_054779.1).
Sequence	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
Gene ID
Swiss Prot
Synonyms	MCT1; MCT-1; MCTS1
Calculated MW	21kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG, 293T
Cellular location	Cytoplasm
Customer validation	IF(Homo sapiens) WB(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus)