제품 > 항체 > 다중클론항체(pAb)

METTL7A Rabbit pAb (A8201)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from 22Rv1 cells, using METTL7A Rabbit pAb (A8201) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - METTL7A Rabbit pAb (A8201)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using METTL7A Rabbit pAb (A8201) at dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human liver using METTL7A Rabbit pAb (A8201) at dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - METTL7A Rabbit pAb (A8201)

Immunofluorescence analysis of L929 cells using METTL7A Rabbit pAb (A8201) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using METTL7A Rabbit pAb (A8201) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	METTL7A Rabbit pAb
Catalog No.	A8201
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable methyltransferase activity. Predicted to be involved in methylation. Located in lipid droplet.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-244 of human METTL7A (NP_054752.3).
Sequence	WICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK
Gene ID
Swiss Prot
Synonyms	AAMB; AAM-B; METTL7A
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	22Rv1
Cellular location	Endoplasmic reticulum, Lipid droplet, Membrane
Customer validation	IHC(Homo sapiens)