Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | MFF Rabbit pAb |
---|---|
Catalog No. | A12392 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 15-170 of human MFF (NP_001263990.1). |
---|---|
Sequence | SRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRN |
Gene ID | |
Swiss Prot | |
Synonyms | EMPF2; GL004; C2orf33; MFF |
Calculated MW | 38kDa |
Observed MW | 38kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | LO2 |
Cellular location | Cytoplasmic vesicle, Mitochondrion outer membrane, Peroxisome, Single-pass type IV membrane protein, secretory vesicle, synaptic vesicle |
Customer validation | WB(Sus scrofa, Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12392? Please let us know so that we can cite the reference in this datasheet.