제품 > 항체 > 다중클론항체(pAb)

MGAT4A Rabbit pAb (A15401)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using MGAT4A Rabbit pAb (A15401) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Review

Overview

Product name	MGAT4A Rabbit pAb
Catalog No.	A15401
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1, 4 linkage to the Man-alpha-1, 3-Man-beta-1, 4-GlcNAc arm of R-Man-alpha-1, 6(GlcNAc-beta-1, 2-Man-alpha-1, 3)Man-beta-1, 4-GlcNAc-beta-1, 4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-100 of human MGAT4A (NP_036346.1).
Sequence	QNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSK
Gene ID
Swiss Prot
Synonyms	GNT-IV; GnT-4a; GNT-IVA; MGAT4A
Calculated MW	62kDa
Observed MW	61kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, K562, Raji, LO2, HeLa
Cellular location	Golgi apparatus membrane, Secreted, Single-pass type II membrane protein
Customer validation	(Mouse Monocyte Macrophage Leukemia Cells)