제품 > 항체 > 다중클론항체(pAb)

MLLT4 Rabbit pAb (A18865)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MLLT4 Rabbit pAb (A18865) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - MLLT4 Rabbit pAb (A18865)

Immunohistochemistry analysis of paraffin-embedded Rat kidney using MLLT4 Rabbit pAb (A18865) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	MLLT4 Rabbit pAb
Catalog No.	A18865
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a multi-domain protein involved in signaling and organization of cell junctions during embryogenesis. It has also been identified as the fusion partner of acute lymphoblastic leukemia (ALL-1) gene, involved in acute myeloid leukemias with t(6;11)(q27;q23) translocation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, however, not all have been fully characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1510-1680 of human MLLT4 (NP_001353249.1).
Sequence	SLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEA
Gene ID
Swiss Prot
Synonyms	AF6; MLLT4; MLL-AF6; l-afadin
Calculated MW	207kDa
Observed MW	200-250kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HT-29, Mouse lung
Cellular location	adherens junction, cell junction, cell-cell contact zone, cell-cell junction, cytosol, nuclear speck, nucleoplasm, plasma membrane, tight junction
Customer validation	Other(Mus musculus)