Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MMP12 Rabbit mAb |
---|---|
Catalog No. | A3713 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0280 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 371-470 of human MMP12 (P39900). |
---|---|
Sequence | FGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC |
Gene ID | |
Swiss Prot | |
Synonyms | ME; HME; MME; MMP-12; MMP12 |
Calculated MW | 54kDa |
Observed MW | 45kDa/54kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, BxPC-3, Mouse lung, Mouse brain, Mouse spleen, Rat lung |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Homo sapiens,Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3713? Please let us know so that we can cite the reference in this datasheet.