Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | MMP7 Rabbit mAb |
---|---|
Catalog No. | A20701 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5088-01 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-267 of human MMP7 (P09237). |
---|---|
Sequence | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
Gene ID | |
Swiss Prot | |
Synonyms | MMP-7; MPSL1; PUMP-1; MMP7 |
Calculated MW | 30kDa |
Observed MW | 20-22kDa/28kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HT-29, 293T, A549, BxPC-3 |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20701? Please let us know so that we can cite the reference in this datasheet.