제품 > 항체 > 단일클론항체(mAb)

MNX1/HB9/HLXB9 Rabbit mAb (A19690)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using MNX1/MNX1/HB9/HLXB9 Rabbit mAb (A19690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	MNX1/HB9/HLXB9 Rabbit mAb
Catalog No.	A19690
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2233

Background

This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MNX1/HB9/HLXB9 (P50219).
Sequence	SQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD
Gene ID
Swiss Prot
Synonyms	HB9; HLXB9; SCRA1; HOXHB9
Calculated MW	41kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, BxPC-3, Raji, Mouse pancreas
Cellular location	Cytosol, Nucleolus, Nucleoplasm, Nucleus
Customer validation	WB(Homo sapiens)