제품 > 항체 > 다중클론항체(pAb)

MOC1 Rabbit pAb (A20329)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using MOC1 Rabbit pAb (A20329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	MOC1 Rabbit pAb
Catalog No.	A20329
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Putative transcription regulator that controls rice tillering by initiating axillary buds and promoting their outgrowth. Rice tiller is a specialized grain-bearing branch that is formed on the unelongated basal internode and grows independently of the mother stem (culm) by means of its own adventitious roots.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of Oryza sativa MOC1. (Q84MM9).
Sequence	MLRSLHSSSSSDTDNNSGGCKNNGGGGGEAAAAVEGGGDQRAVAAAAPSTRDLLLACADLLQRGDLPAARRAAEIVLAAAASPRGDAADRLAYHFARALA
Gene ID
Swiss Prot
Synonyms	MOC1
Calculated MW	46kDa
Observed MW	50kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	stems (before flower), leaves sheath (before flower)
Cellular location	nucleus