Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MOXD1 Rabbit pAb |
---|---|
Catalog No. | A4600 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 390-590 of human MOXD1 (NP_056344.2). |
---|---|
Sequence | AHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLH |
Gene ID | |
Swiss Prot | |
Synonyms | MOX; PRO5780; dJ248E1.1; MOXD1 |
Calculated MW | 70kDa |
Observed MW | 75kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG, NCI-H460, A-431, Jurkat, Raji, Mouse uterus, Rat brain |
Cellular location | Endoplasmic reticulum membrane, Single-pass type I membrane protein |
Customer validation | WB(Homo sapiens,Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4600? Please let us know so that we can cite the reference in this datasheet.