제품 > 항체 > 다중클론항체(pAb)

MOXD1 Rabbit pAb (A4600)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MOXD1 Rabbit pAb (A4600) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	MOXD1 Rabbit pAb
Catalog No.	A4600
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable copper ion binding activity and dopamine beta-monooxygenase activity. Predicted to be involved in dopamine catabolic process; norepinephrine biosynthetic process; and octopamine biosynthetic process. Part of endoplasmic reticulum membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 390-590 of human MOXD1 (NP_056344.2).
Sequence	AHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLH
Gene ID
Swiss Prot
Synonyms	MOX; PRO5780; dJ248E1.1; MOXD1
Calculated MW	70kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, NCI-H460, A-431, Jurkat, Raji, Mouse uterus, Rat brain
Cellular location	Endoplasmic reticulum membrane, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens,Mus musculus)