Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | MRPL22 Rabbit pAb |
---|---|
Catalog No. | A14586 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 97-206 of human MRPL22 (NP_054899.2). |
---|---|
Sequence | LAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL |
Gene ID | |
Swiss Prot | |
Synonyms | L22mt; RPML25; HSPC158; MRP-L22; MRP-L25; MRPL22 |
Calculated MW | 24kDa |
Observed MW | 24kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Mouse heart, Mouse kidney, Rat lung |
Cellular location | Mitochondrion |
* For research use only. Not for therapeutic or diagnostic purposes.