Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MSR1 Rabbit mAb |
---|---|
Catalog No. | A2401 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0750 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSR1 (P21757). |
---|---|
Sequence | MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWETKNCSVSSTNANDITQSLTGK |
Gene ID | |
Swiss Prot | |
Synonyms | SRA; SR-A; CD204; SR-AI; phSR1; phSR2; SCARA1; SR-AII; SR-AIII; MSR1 |
Calculated MW | 50kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, HeLa, NIH/3T3, C6 treated by TPA and LPS |
Cellular location | cytosol, external side of plasma membrane, plasma membrane. |
Customer validation | IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2401? Please let us know so that we can cite the reference in this datasheet.