Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MST1/STK4 Rabbit pAb |
---|---|
Catalog No. | A8043 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 303-487 of human MST1/STK4 (NP_006273.1). |
---|---|
Sequence | KRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF |
Gene ID | |
Swiss Prot | |
Synonyms | KRS2; MST1; YSK3; K4 |
Calculated MW | 56kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | U-87MG, HepG2, HeLa, MCF-7, Mouse brain, Mouse lung, Mouse spleen, Rat liver |
Cellular location | Cytoplasm, Nucleus |
Customer validation | IF(Homo sapiens) WB(Mus musculus, Homo sapiens, Drosophila melanogaster) IHC(Homo sapiens) Co-IP(Drosophila melanogaster) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8043? Please let us know so that we can cite the reference in this datasheet.