제품 > 항체 > 다중클론항체(pAb)

MT-ATP8 Rabbit pAb (A17890)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MT-ATP8 Rabbit pAb (A17890) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - MT-ATP8 Rabbit pAb (A17890)

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using MT-ATP8 Rabbit pAb (A17890) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - MT-ATP8 Rabbit pAb (A17890)

Immunofluorescence analysis of HeLa cells using MT-ATP8 Rabbit pAb (A17890) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	MT-ATP8 Rabbit pAb
Catalog No.	A17890
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Contributes to proton-transporting ATP synthase activity, rotational mechanism. Involved in mitochondrial ATP synthesis coupled proton transport. Part of mitochondrial proton-transporting ATP synthase complex. Implicated in multiple sclerosis and urinary bladder cancer.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-68 of human MT-ATP8 (YP_003024030.1).
Sequence	MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS
Gene ID
Swiss Prot
Synonyms	ATPase8; MTATP8; ATP8; MT-ATP8
Calculated MW	8kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, A-549, 293F, Rat brain
Cellular location	mitochondrial inner membrane, mitochondrial proton-transporting ATP synthase complex, mitochondrial proton-transporting ATP synthase complex, coupling factor F(o).
Customer validation	WB(Homo sapiens, Rattus norvegicus, Mus musculus, Other)