제품 > 항체 > 단일클론항체(mAb)

MTCO1 Rabbit mAb (A24805)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using MTCO1 Rabbit mAb (A24805) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - MTCO1 Rabbit mAb (A24805)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using MTCO1 Rabbit mAb (A24805) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using MTCO1 Rabbit mAb (A24805) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using MTCO1 Rabbit mAb (A24805) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using MTCO1 Rabbit mAb (A24805) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	MTCO1 Rabbit mAb
Catalog No.	A24805
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59941

Background

Enables cytochrome-c oxidase activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, cytochrome c to oxygen; and response to oxidative stress. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex IV. Is expressed in several structures, including brown fat; heart; liver; metanephros; and skeletal muscle. Orthologous to human MT-CO1 (mitochondrially encoded cytochrome c oxidase I).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 479-513 of human MTCO1(YP_003024028.1).
Sequence	KRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
Gene ID
Swiss Prot
Synonyms	CoxI; COX1; MTCO1
Calculated MW	57kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SH-SY5Y, THP-1
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein.
Customer validation	WB(Cyprinus carpio)