제품 > 항체 > 다중클론항체(pAb)

MTCO2 Rabbit pAb (A11522)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using MTCO2 Rabbit pAb (A11522) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - MTCO2 Rabbit pAb (A11522)

Immunohistochemistry analysis of paraffin-embedded mouse brain using MTCO2 Rabbit pAb (A11522) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat kidney using MTCO2 Rabbit pAb (A11522) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review

Overview

Product name	MTCO2 Rabbit pAb
Catalog No.	A11522
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport; positive regulation of cellular biosynthetic process; and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo; epiblast; heart; liver; and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MTCO2 (NP_904331.1).
Sequence	GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Gene ID
Swiss Prot
Synonyms	COX2; MTCO2
Calculated MW	26kDa
Observed MW	23kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver, Mouse heart, Mouse kidney, Rat liver, Rat kidney
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation	(Mouse heart) IF(Homo sapiens) IHC(Rattus norvegicus) WB(Homo sapiens, Mus musculus, Gallus gallus)