제품 > 항체 > 다중클론항체(pAb)

MT-CO3 Rabbit pAb (A9939)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using MT-CO3 antibody (A9939) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	MT-CO3 Rabbit pAb
Catalog No.	A9939
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable electron transfer activity and oxidoreduction-driven active transmembrane transporter activity. Predicted to be involved in mitochondrial electron transport, cytochrome c to oxygen and respiratory chain complex IV assembly. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; heart; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in MELAS syndrome. Orthologous to human MT-CO3 (mitochondrially encoded cytochrome c oxidase III).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse MT-CO3 (NP_904334.1).
Sequence	MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWA
Gene ID
Swiss Prot
Synonyms	COX3
Calculated MW	29kDa
Observed MW	30kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver, Rat liver
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation	WB(Rattus norvegicus, Homo sapiens, Gallus gallus)