Review (1)Publications (4) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | MT-ND2 Rabbit pAb |
---|---|
Catalog No. | A6180 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse MT-ND2 (NP_904329.1). |
---|---|
Sequence | PRSTEAATKYFVTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLN |
Gene ID | |
Swiss Prot | |
Synonyms | ND2; MT-ND2 |
Calculated MW | 38kDa |
Observed MW | 38kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | mouse liver, mouse heart, rat liver |
Cellular location | Mitochondrion inner membrane, Multi-pass membrane protein |
Customer validation | (Mouse muscle) WB(Sus scrofa, Mus musculus, Homo sapiens, Other) |
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A6180? Please let us know so that we can cite the reference in this datasheet.