제품 > 항체 > 다중클론항체(pAb)

MT-ND2 Rabbit pAb (A6180)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using MT-ND2 Rabbit pAb (A6180) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Review

Overview

Product name	MT-ND2 Rabbit pAb
Catalog No.	A6180
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable NADH dehydrogenase (ubiquinone) activity; ionotropic glutamate receptor binding activity; and protein kinase binding activity. Acts upstream of or within reactive oxygen species metabolic process. Located in mitochondrion. Is expressed in early conceptus and secondary oocyte. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; multiple sclerosis; myocardial infarction; neurodegenerative disease (multiple); and urinary bladder cancer. Orthologous to human MT-ND2 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 2).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse MT-ND2 (NP_904329.1).
Sequence	PRSTEAATKYFVTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLN
Gene ID
Swiss Prot
Synonyms	ND2; MT-ND2
Calculated MW	38kDa
Observed MW	38kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	mouse liver, mouse heart, rat liver
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation	(Mouse muscle) WB(Sus scrofa, Mus musculus, Homo sapiens, Other)