Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MT-ND3 Rabbit pAb |
---|---|
Catalog No. | A9940 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse MT-ND3 (NP_904335.1). |
---|---|
Sequence | MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSL |
Gene ID | |
Swiss Prot | |
Synonyms | ND3 |
Calculated MW | 13kDa |
Observed MW | 13kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, 293T, HeLa, PC-12, Mouse liver, Rat liver |
Cellular location | Mitochondrion membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens, Other) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9940? Please let us know so that we can cite the reference in this datasheet.