제품 > 항체 > 다중클론항체(pAb)

MT-ND3 Rabbit pAb (A9940)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using MT-ND3 Antibody (A9940) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	MT-ND3 Rabbit pAb
Catalog No.	A9940
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in cellular response to glucocorticoid stimulus; mitochondrial electron transport, NADH to ubiquinone; and response to oxidative stress. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and Parkinson's disease. Orthologous to human MT-ND3 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 3).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse MT-ND3 (NP_904335.1).
Sequence	MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSL
Gene ID
Swiss Prot
Synonyms	ND3
Calculated MW	13kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, 293T, HeLa, PC-12, Mouse liver, Rat liver
Cellular location	Mitochondrion membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)