Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | MUC4 Rabbit mAb |
---|---|
Catalog No. | A3438 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1999 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102). |
---|---|
Sequence | WATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGD |
Gene ID | |
Swiss Prot | |
Synonyms | ASGP; MUC-4; HSA276359; MUC4 |
Calculated MW | 542kDa |
Observed MW | 120kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa |
Cellular location | Extracellular exosome, Extracellular space, Golgi lumen, Plasma membrane |
Customer validation | IHC(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3438? Please let us know so that we can cite the reference in this datasheet.