제품 > 항체 > 단일클론항체(mAb)

MYH14 Rabbit mAb (A21933)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from mouse lung, using MYH14 Rabbit mAb (A21933) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of various lysates using MYH14 Rabbit mAb (A21933) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - MYH14 Rabbit mAb (A21933)

Confocal imaging of paraffin-embedded Human colon cancer using MYH14 Rabbit mAb (A21933, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded mouse small intestine using MYH14 Rabbit mAb (A21933, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	MYH14 Rabbit mAb
Catalog No.	A21933
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53864

Background

This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-14 (MYO14). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene result in one form of autosomal dominant hearing impairment. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH14 (NP_079005.3).
Sequence	AGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNH
Gene ID
Swiss Prot
Synonyms	DFNA4; MHC16; MYH17; PNMHH; DFNA4A; myosin; FP17425; NMHC II-C; NMHC-II-C; MYH14
Calculated MW	228kDa
Observed MW	250kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, Mouse lung, Rat lung
Cellular location	cytosol, extracellular exosome, growth cone
Customer validation	IF(Homo sapiens)