Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Western blot analysis of various lysates using MYH6/α-MHC Rabbit pAb (A12964) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of paraffin-embedded mouse heart using MYH6/α-MHC Rabbit pAb (A12964) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of paraffin-embedded rat heart using MYH6/α-MHC Rabbit pAb (A12964) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of paraffin-embedded mouse heart using MYH6/α-MHC Rabbit pAb (A12964) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of paraffin-embedded rat heart using MYH6/α-MHC Rabbit pAb (A12964) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
| Product name | MYH6/α-MHC Rabbit pAb |
|---|---|
| Catalog No. | A12964 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human MYH6/α-MHC (NP_002462.2). |
|---|---|
| Sequence | MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIR |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ASD3; MYHC; SSS3; CMH14; MYHCA; CMD1EE; alpha-MHC; MYH6/α-MHC |
| Calculated MW | 224kDa |
| Observed MW | 250kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Mouse skeletal muscle |
| Cellular location | Cytoplasm, myofibril. |
| Customer validation | IF(Mus musculus) WB(Bos taurus, Rattus norvegicus, Homo sapiens, Mus musculus) IF(Homo sapiens) FC(Bos taurus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12964? Please let us know so that we can cite the reference in this datasheet.
