제품 > 항체 > 다중클론항체(pAb)

MYO18A Rabbit pAb (A9015)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MYO18A Rabbit pAb (A9015) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	MYO18A Rabbit pAb
Catalog No.	A9015
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene can bind GOLPH3, linking the Golgi to the cytoskeleton and influencing Golgi membrane trafficking. The encoded protein is also part of a complex that assembles lamellar actomyosin bundles and may be required for cell migration.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2).
Sequence	SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
Gene ID
Swiss Prot
Synonyms	MAJN; TIAF1; MYSPDZ; SPR210; SP-R210; MYO18A
Calculated MW	233kDa
Observed MW	260kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-251MG, HeLa, Jurkat, Mouse brain, Mouse liver, Rat brain
Cellular location	Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Golgi apparatus, cytoskeleton, trans-Golgi network