제품 > 항체 > 다중클론항체(pAb)

MYOT Rabbit pAb (A6439)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using MYOT antibody (A6439) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunofluorescence - MYOT Rabbit pAb (A6439)

Immunofluorescence analysis of U2OS cells using MYOT antibody (A6439). Blue: DAPI for nuclear staining.

Overview

Product name	MYOT Rabbit pAb
Catalog No.	A6439
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a cystoskeletal protein which plays a significant role in the stability of thin filaments during muscle contraction. This protein binds F-actin, crosslinks actin filaments, and prevents latrunculin A-induced filament disassembly. Mutations in this gene have been associated with limb-girdle muscular dystrophy and myofibrillar myopathies. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 259-314 of human MYOT (NP_001129412.1).
Sequence	RPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL
Gene ID
Swiss Prot
Synonyms	MFM3; TTID; TTOD; LGMD1; LGMD1A
Calculated MW	55kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:10 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HepG2, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart
Cellular location	Cell membrane, Cytoplasm, Z line, cytoskeleton, myofibril, sarcolemma, sarcomere
Customer validation	WB(Homo sapiens)