제품 > 항체 > 다중클론항체(pAb)

Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308)

Immunofluorescence analysis of C6 cells using Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using Mineralocorticoid receptor (NR3C2) Rabbit pAb (A3308) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Mineralocorticoid receptor (NR3C2) Rabbit pAb
Catalog No.	A3308
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 450-600 of human Mineralocorticoid receptor (NR3C2) (NP_000892.2).
Sequence	FPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
Gene ID
Swiss Prot
Synonyms	MR; MCR; MLR; NR3C2VIT; Mineralocorticoid receptor (NR3C2)
Calculated MW	107kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, 293T, Mouse liver, Mouse kidney, Rat liver
Cellular location	Cytoplasm, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein
Customer validation	WB(Homo sapiens, Mus musculus) ELISA(Mus musculus)