Review (1)Publications (7) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Myelin Basic Protein Rabbit mAb |
---|---|
Catalog No. | A11162 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0535 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686). |
---|---|
Sequence | GFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR |
Gene ID | |
Swiss Prot | |
Synonyms | MBP; myelin basic protein; Myelin Basic Protein |
Calculated MW | 33kDa |
Observed MW | 14-23kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cytoplasmic side, Myelin membrane, Nucleus, Peripheral membrane protein. |
Customer validation | (Mouse brain) WB(Mus musculus, Arabidopsis thaliana) IF(Homo sapiens, Mus musculus) WB(Mus musculus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11162? Please let us know so that we can cite the reference in this datasheet.