Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Myogenin Rabbit pAb |
---|---|
Catalog No. | A17427 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Myogenin (NP_002470.2). |
---|---|
Sequence | AFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN |
Gene ID | |
Swiss Prot | |
Synonyms | MYF4; myf-4; bHLHc3; Myogenin |
Calculated MW | 25kDa |
Observed MW | 25kDa/40kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | NIH/3T3, Rat heart |
Cellular location | Nucleus. |
Customer validation | IHC(Equus caballus) WB(Mus musculus, Merycoidodon gracilis, Homo sapiens, Gallus gallus, Sus scrofa, Danio rerio) IF(Mus musculus) ChIP(Homo sapiens) IF(Gallus gallus, Sus scrofa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17427? Please let us know so that we can cite the reference in this datasheet.