제품 > 항체 > 단일클론항체(mAb)

Myoglobin Rabbit mAb (A11368)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using Myoglobin Rabbit mAb (A11368) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	Myoglobin Rabbit mAb
Catalog No.	A11368
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0582

Background

This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144).
Sequence	EMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Gene ID
Swiss Prot
Synonyms	MYOSB; PVALB
Calculated MW	17kDa
Observed MW	17kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart
Cellular location	cytosol, extracellular exosome
Customer validation	WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus)