Reviews (2)Publications (4) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Myosin heavy chain Rabbit mAb |
---|---|
Catalog No. | A4963 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1170 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1400 of human Myosin heavy chain (P12883). |
---|---|
Sequence | VAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEA |
Gene ID | |
Swiss Prot | |
Synonyms | CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM; Myosin heavy chain |
Calculated MW | 224kDa |
Observed MW | 250kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse lung, Mouse skeletal muscle, Rat heart |
Cellular location | Cytoplasm, myofibril. |
Customer validation | (myocardium) WB(Mus musculus) IF(Mus musculus, Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A4963? Please let us know so that we can cite the reference in this datasheet.