제품 > 항체 > 다중클론항체(pAb)

NAPSA Rabbit pAb (A5594)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of A-549 cells, using NAPSA antibody (A5594) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - NAPSA Rabbit pAb (A5594)

Immunofluorescence analysis of rat lung cells using NAPSA Rabbit pAb (A5594) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of human lung cancer cells using NAPSA Rabbit pAb (A5594) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse lung cells using NAPSA Rabbit pAb (A5594) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	NAPSA Rabbit pAb
Catalog No.	A5594
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 321-420 of human NAPSA (NP_004842.1).
Sequence	PKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Gene ID
Swiss Prot
Synonyms	KAP; Kdap; NAP1; NAPA; SNAPA
Calculated MW	45kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549
Cellular location	Secreted
Customer validation	IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NAPSA Rabbit pAb images

Western blot - NAPSA Rabbit pAb (A5594)

Immunofluorescence - NAPSA Rabbit pAb (A5594)

Immunofluorescence analysis of rat lung cells using NAPSA Rabbit pAb (A5594) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - NAPSA Rabbit pAb (A5594)

Immunofluorescence analysis of human lung cancer cells using NAPSA Rabbit pAb (A5594) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - NAPSA Rabbit pAb (A5594)

Immunofluorescence analysis of mouse lung cells using NAPSA Rabbit pAb (A5594) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.