제품 > 항체 > 다중클론항체(pAb)

NDUFS5 Rabbit pAb (A21505)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using NDUFS5 antibody (A21505) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - NDUFS5 Rabbit pAb (A21505)

Immunofluorescence analysis of NIH/3T3 cells using NDUFS5 Rabbit pAb (A21505) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	NDUFS5 Rabbit pAb
Catalog No.	A21505
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1).
Sequence	MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Gene ID
Swiss Prot
Synonyms	CI15K; CI-15k
Calculated MW	13kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Peripheral membrane protein